Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NRN1 protein (Active)

This Human NRN1 protein (Active) spans the amino acid sequence from region 28-115aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

NRN

UniProt

Q9NPD7

Expression Region

28-115aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by by a cell proliferation assay using rat C6 cells is less than 25 ng/ml, corresponding to a specific activity of > 4.0 x 10 ^ 4 IU/mg.

Form

Lyophilized powder

Molecular Weight

9.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

AGKCDAVFKGFSDCLLKLGDSMANYPQGLDDKTNIKTVCTYWEDFHSCTVTALTDCQEGAKDMWDKLRKESKNLNIQGSLFELCGSGN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

58K Golgi Protein Recombinant Rabbit mAb
BS47321 50 ul

58K Golgi Protein Recombinant Rabbit mAb

Sign In for Pricing
View Details
Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) TIE1 Polyclonal Antibody
MBS7142308 Inquire

Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) TIE1 Polyclonal Antibody

Sign In for Pricing
View Details
MSX2 (NM_002449) Human Tagged ORF Clone
RG202056 10 µg

MSX2 (NM_002449) Human Tagged ORF Clone

Sign In for Pricing
View Details
BBX Human shRNA Plasmid Kit (Locus ID 56987)
TR306432 1 Kit

BBX Human shRNA Plasmid Kit (Locus ID 56987)

Sign In for Pricing
View Details
Osbpl6 Rat shRNA Lentiviral Particle (Locus ID 311129)
TL706284V 500 µL Each

Osbpl6 Rat shRNA Lentiviral Particle (Locus ID 311129)

Sign In for Pricing
View Details
Human BLVRA Recombinant Protein
PPT-10858 100 µg

Human BLVRA Recombinant Protein

Sign In for Pricing
View Details