Human NRG1 protein (Active)
This Human NRG1 protein (Active) spans the amino acid sequence from region 177-241aa. Purity: > 97% as determined by SDS-PAGE and HPLC.
Product Specifications
Product Name Alternative
Pro-NRG1, ARIA, Breast cancer cell differentiation factor p45, Glial growth factor, Heregulin
UniProt
Q02297
Expression Region
177-241aa
Tag
Tag-Free
Source
E.Coli
Origin
Homo sapiens (Human)
Field of Research
Cancer Biology
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
> 97% as determined by SDS-PAGE and HPLC.
Bioactivity
Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using serum free human MCF-7 cells is less than 40 ng/ml, corresponding to a specific activity of > 2.5 x 10 ^ 4 IU/mg.
Form
Lyophilized powder
Molecular Weight
7.4 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
Lyophilized from a 0.2 μm filtered 20 mM PB, pH 6.0, 150 mM NaCl
AA Sequence
SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCQPGFTGARCTENVPMKVQNQEKAEELYQK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2124851-01 0.1 mL
APC-Linked Monoclonal Antibody to Tumor Protein p53 (P53)
Sign In for Pricing
View Details MBS2124851-02 0.2 mL
APC-Linked Monoclonal Antibody to Tumor Protein p53 (P53)
Sign In for Pricing
View Details MBS2124851-03 0.5 mL
APC-Linked Monoclonal Antibody to Tumor Protein p53 (P53)
Sign In for Pricing
View Details MBS2124851-04 1 mL
APC-Linked Monoclonal Antibody to Tumor Protein p53 (P53)
Sign In for Pricing
View Details MBS2124851-05 5 mL
APC-Linked Monoclonal Antibody to Tumor Protein p53 (P53)
Sign In for Pricing
View Details MBS2124851-06 5x 5 mL
APC-Linked Monoclonal Antibody to Tumor Protein p53 (P53)
Sign In for Pricing
View Details