Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GDNF protein (Active)

This Human GDNF protein (Active) spans the amino acid sequence from region 78-211aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

HGDNF, ATF

UniProt

P39905

Expression Region

78-211aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using rat C6 cells is less than 0.1 ng/ml, corresponding to a specific activity of > 5.0 x 10 ^ 7 IU/mg.

Form

Lyophilized powder

Molecular Weight

15.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered 1 x PBS, pH 7.4, with 0.05 % Tween-20

AA Sequence

SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OTX1 (orthodenticle Homeobox 1, FLJ38361, MGC15736) (MaxLight 405)
MBS6197065-01 0.1 mL

OTX1 (orthodenticle Homeobox 1, FLJ38361, MGC15736) (MaxLight 405)

Sign In for Pricing
View Details
OTX1 (orthodenticle Homeobox 1, FLJ38361, MGC15736) (MaxLight 405)
MBS6197065-02 5x 0.1 mL

OTX1 (orthodenticle Homeobox 1, FLJ38361, MGC15736) (MaxLight 405)

Sign In for Pricing
View Details
5-TRITC; G isomer [Tetramethylrhodamine-5-isothiocyanate]
sc-495733 1 mg

5-TRITC; G isomer [Tetramethylrhodamine-5-isothiocyanate]

Sign In for Pricing
View Details
Mouse Monoclonal HBsAg Antibody (HB11) [Janelia Fluor 585]
NB110-7391JF585 0.2 mL

Mouse Monoclonal HBsAg Antibody (HB11) [Janelia Fluor 585]

Sign In for Pricing
View Details
Eef2k sgRNA CRISPR Lentivector (Rat) (Target 1)
K6802502 1.0 µg DNA

Eef2k sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Hypoxia Inducible Factor 1 Alpha (HIF1a) Antibody (FITC)
abx107558-01 20 µg

Hypoxia Inducible Factor 1 Alpha (HIF1a) Antibody (FITC)

Sign In for Pricing
View Details