Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CNTF protein (Active)

This Human CNTF protein (Active) spans the amino acid sequence from region 1-200aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

CNTF

UniProt

P26441

Expression Region

1-200aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 150 ng/ml, corresponding to a specific activity of > 6.7 x 10 ^ 3 IU/mg.

Form

Lyophilized powder

Molecular Weight

22.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

20-HETE purified eicosanoid
20HCHEM1 100 ug

20-HETE purified eicosanoid

Sign In for Pricing
View Details
RFPL4B Protein Vector (Human) (pPM-C-HA)
PV057095 500 ng

RFPL4B Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
MODIfinder DigIT Soy/Rice Duplex kit 96 Tests
DGE0913K-50 Kit 96 Tests

MODIfinder DigIT Soy/Rice Duplex kit 96 Tests

Sign In for Pricing
View Details
PMPCB Rabbit Polyclonal Antibody (BF555)
orb2395830 100 µL

PMPCB Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
CD300E Protein, Human, Recombinant (hFc)
TMPY-00185-01 5 µg

CD300E Protein, Human, Recombinant (hFc)

Sign In for Pricing
View Details
CD300E Protein, Human, Recombinant (hFc)
TMPY-00185-02 10 µg

CD300E Protein, Human, Recombinant (hFc)

Sign In for Pricing
View Details