Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human AREG protein (Active)

This Human AREG protein (Active) spans the amino acid sequence from region 101-198aa. Purity: > 95% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

AR, CRDGF

UniProt

P15514

Expression Region

101-198aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 95% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine Balb/c 3T3 cells is between 5-10 ng/ml.

Form

Lyophilized powder

Molecular Weight

11.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

SVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZD-1611 50mg
A13151-50 50 mg

ZD-1611 50mg

Sign In for Pricing
View Details
Gabbr2 sgRNA CRISPR Lentivector set (Rat)
K7549801 3x 1.0 µg

Gabbr2 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Chicken IL-10 ELISA Kit
RK04580 96 Tests

Chicken IL-10 ELISA Kit

Sign In for Pricing
View Details
UPGL00004 50mg
A19047-50 50 mg

UPGL00004 50mg

Sign In for Pricing
View Details
CYP8B1 Protein Vector (Rat) (pPM-C-HA)
17534026 500 ng

CYP8B1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
RASA2 Antibody
37861 100 µL

RASA2 Antibody

Sign In for Pricing
View Details