Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human EPGN protein (Active)

This Human EPGN protein (Active) spans the amino acid sequence from region 24-95aa. Purity: > 98% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Epithelial mitogen

UniProt

Q6UW88

Expression Region

24-95aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 98% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine Balb/c 3T3 cells is less than 300 ng/ml, corresponding to a specific activity of > 3.3 x 10 ^ 3 IU/mg.

Form

Lyophilized powder

Molecular Weight

7.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

AVTVTPPITAQQADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTSYA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Sodium channel subunit beta-3, SCN3B ELISA KIT
ELI-35814b 96 Tests

Bovine Sodium channel subunit beta-3, SCN3B ELISA KIT

Sign In for Pricing
View Details
Recombinant Mycoplasma Hyopneumoniae rpsI Protein (aa 1-132) (strain 232)
VAng-Lsx06631-1mgEcoli 1 mg (E. coli)

Recombinant Mycoplasma Hyopneumoniae rpsI Protein (aa 1-132) (strain 232)

Sign In for Pricing
View Details
Barium Chloranilate AR/ACS
461790 25 g

Barium Chloranilate AR/ACS

Sign In for Pricing
View Details
Rabbit Polyclonal FKBP6 Antibody [Alexa Fluor 532]
NBP2-97729AF532 0.1 mL

Rabbit Polyclonal FKBP6 Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details
RAD54B (NM_012415) Human Untagged Clone
SC115426 10 µg

RAD54B (NM_012415) Human Untagged Clone

Sign In for Pricing
View Details
GENLISA™ Human Leukocyte immunoglobulin - like receptor subfamily B member 2 (LILRB2) ELISA
KBH21443 96 Well

GENLISA™ Human Leukocyte immunoglobulin - like receptor subfamily B member 2 (LILRB2) ELISA

Sign In for Pricing
View Details