Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IGF2 protein (Active)

This Human IGF2 protein (Active) spans the amino acid sequence from region 25-91aa. Purity: > 98% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

IGF-II, T3M-11-derived growth factor

UniProt

P01344

Expression Region

25-91aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 98% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using serum free human MCF-7 cells is less than 2 ng/ml, corresponding to a specific activity of > 5.0 x 10 ^ 5 IU/mg.

Form

Lyophilized powder

Molecular Weight

7.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, pH 8.0, 150 mM NaCl, with 0.02 % Tween-20

AA Sequence

AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmem81 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6643608 1.0 µg DNA

Tmem81 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Anti-SERPINB12 Antibody
MBS500187-01 0.1 mL

Anti-SERPINB12 Antibody

Sign In for Pricing
View Details
Anti-SERPINB12 Antibody
MBS500187-02 5x 0.1 mL

Anti-SERPINB12 Antibody

Sign In for Pricing
View Details
MAP1LC3A Rabbit Polyclonal Antibody (BF680)
orb1590878 100 µL

MAP1LC3A Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
C18orf57 ORF Vector (Human) (pORF)
14042011 1.0 µg DNA

C18orf57 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
RPL36 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
41533064 1.0 µg DNA

RPL36 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details