Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IGF2 protein (Active)

This Human IGF2 protein (Active) spans the amino acid sequence from region 25-91aa. Purity: > 98% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

IGF-II, T3M-11-derived growth factor

UniProt

P01344

Expression Region

25-91aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 98% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using serum free human MCF-7 cells is less than 2 ng/ml, corresponding to a specific activity of > 5.0 x 10 ^ 5 IU/mg.

Form

Lyophilized powder

Molecular Weight

7.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, pH 8.0, 150 mM NaCl, with 0.02 % Tween-20

AA Sequence

AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CX3CR1 (CX3C Chemokine Receptor 1, V28l, CCRL1, GPR13, CMKDR1, GPRV28, CMKBRL1) (MaxLight 550)
MBS6413193-01 0.1 mL

CX3CR1 (CX3C Chemokine Receptor 1, V28l, CCRL1, GPR13, CMKDR1, GPRV28, CMKBRL1) (MaxLight 550)

Sign In for Pricing
View Details
CX3CR1 (CX3C Chemokine Receptor 1, V28l, CCRL1, GPR13, CMKDR1, GPRV28, CMKBRL1) (MaxLight 550)
MBS6413193-02 5x 0.1 mL

CX3CR1 (CX3C Chemokine Receptor 1, V28l, CCRL1, GPR13, CMKDR1, GPRV28, CMKBRL1) (MaxLight 550)

Sign In for Pricing
View Details
Sodium Pyruvate
S-117-5-5kg 5 Kg

Sodium Pyruvate

Sign In for Pricing
View Details
Rat Neurochondrin (NCDN) ELISA Kit
RDR-NCDN-Ra-48Tests 48 Tests

Rat Neurochondrin (NCDN) ELISA Kit

Sign In for Pricing
View Details
AceCS1 (D19C6) Rabbit Monoclonal Antibody
CST 3658S 100 µL

AceCS1 (D19C6) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Cleaved-Notch 2 (V1697) Polyclonal Antibody
RA23519-01 50 µL

Cleaved-Notch 2 (V1697) Polyclonal Antibody

Sign In for Pricing
View Details