Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IGF1 protein (Active)

This Human IGF1 protein (Active) spans the amino acid sequence from region 52-118aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

IGF-I, MGF, Somatomedin-C

UniProt

P05019

Expression Region

52-118aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using serum free human MCF-7 cells is less than 2 ng/ml, corresponding to a specific activity of > 5.0 x 10 ^ 5 IU/mg.

Form

Lyophilized powder

Molecular Weight

7.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DOPEY2 Rabbit Polyclonal Antibody (PerCP)
orb2514950 100 µL

DOPEY2 Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
OR10AG1, CT (OR10AG1, Olfactory receptor 10AG1, Olfactory receptor OR11-160) (AP) discontinued
039300-AP 200 µL

OR10AG1, CT (OR10AG1, Olfactory receptor 10AG1, Olfactory receptor OR11-160) (AP) discontinued

Sign In for Pricing
View Details
DDX56, CT (DDX56, DDX21, NOH61, Probable ATP-dependent RNA helicase DDX56, ATP-dependent 61kD nucleolar RNA helicase, DEAD box protein 21, DEAD box protein 56) (MaxLight 550) discontinued
034562-ML550 100 µL

DDX56, CT (DDX56, DDX21, NOH61, Probable ATP-dependent RNA helicase DDX56, ATP-dependent 61kD nucleolar RNA helicase, DEAD box protein 21, DEAD box protein 56) (MaxLight 550) discontinued

Sign In for Pricing
View Details
HDAC3 Polyclonal Antibody
MBS9243882-01 0.1 mL

HDAC3 Polyclonal Antibody

Sign In for Pricing
View Details
HDAC3 Polyclonal Antibody
MBS9243882-02 5x 0.1 mL

HDAC3 Polyclonal Antibody

Sign In for Pricing
View Details
3-Amino-2,6-dimethyl-5-phenyl-3H,4H-thieno[2,3-d]pyrimidin-4-one
TBA08853-01 250 mg

3-Amino-2,6-dimethyl-5-phenyl-3H,4H-thieno[2,3-d]pyrimidin-4-one

Sign In for Pricing
View Details