Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FGF21 protein (Active)

This Human FGF21 protein (Active) spans the amino acid sequence from region 29-209aa. Purity: > 96% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

FGF-21

UniProt

Q9NSA1

Expression Region

29-209aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 96% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by thymidine uptake assay using FGF-receptors transfected BaF3 cells is less than 0.5 μg/ml, corresponding to a specific activity of > 2.0 x 10 ^ 3 IU/mg in the presence of 5 μg/ml of rMuKlotho-β and 10 μg/ml of heparin.

Form

Lyophilized powder

Molecular Weight

19.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Gimap5 shRNA (UAS) - Lentiviral mouse Gimap5 shRNA (UAS, RFP) plasmid
GTR15258049 1 Vial

Lentiviral mouse Gimap5 shRNA (UAS) - Lentiviral mouse Gimap5 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Recombinant Vibrio cholerae serotype O1 Uridylate kinase (pyrH)
MBS1054358-01 0.02 mg (E-Coli)

Recombinant Vibrio cholerae serotype O1 Uridylate kinase (pyrH)

Sign In for Pricing
View Details
Recombinant Vibrio cholerae serotype O1 Uridylate kinase (pyrH)
MBS1054358-02 0.1 mg (E-Coli)

Recombinant Vibrio cholerae serotype O1 Uridylate kinase (pyrH)

Sign In for Pricing
View Details
Recombinant Vibrio cholerae serotype O1 Uridylate kinase (pyrH)
MBS1054358-03 0.02 mg (Yeast)

Recombinant Vibrio cholerae serotype O1 Uridylate kinase (pyrH)

Sign In for Pricing
View Details
Recombinant Vibrio cholerae serotype O1 Uridylate kinase (pyrH)
MBS1054358-04 0.1 mg (Yeast)

Recombinant Vibrio cholerae serotype O1 Uridylate kinase (pyrH)

Sign In for Pricing
View Details
Recombinant Vibrio cholerae serotype O1 Uridylate kinase (pyrH)
MBS1054358-05 0.02 mg (Baculovirus)

Recombinant Vibrio cholerae serotype O1 Uridylate kinase (pyrH)

Sign In for Pricing
View Details