Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FGF17 protein (Active)

This Human FGF17 protein (Active) spans the amino acid sequence from region 23-216aa. Purity: > 95% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

FGF-17

UniProt

O60258

Expression Region

23-216aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 95% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine balb/c 3T3 cells is less than 10 ng/ml, corresponding to a specific activity of >1.0 x 10 ^ 5 IU/mg.

Form

Lyophilized powder

Molecular Weight

22.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

M+TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Samhd1 (NM_001191743) Rat Untagged Clone
RN217011 10 µg

Samhd1 (NM_001191743) Rat Untagged Clone

Sign In for Pricing
View Details
WEE1 (Biotin)
581533-01 50 µg

WEE1 (Biotin)

Sign In for Pricing
View Details
WEE1 (Biotin)
581533-02 100 µg

WEE1 (Biotin)

Sign In for Pricing
View Details
Anti-EPOR (rhEPO-Fc) Biosimilar (Monoclonal, IgG)
A136087 100 µL

Anti-EPOR (rhEPO-Fc) Biosimilar (Monoclonal, IgG)

Sign In for Pricing
View Details
PcDNA3.1 (+) -MSH3-3*HA
PPL02022-2a 1 Each

PcDNA3.1 (+) -MSH3-3*HA

Sign In for Pricing
View Details
EPC2 Double Nickase Plasmid (h)
sc-407068-NIC 20 µg

EPC2 Double Nickase Plasmid (h)

Sign In for Pricing
View Details