Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FGF9 protein (Active)

This Human FGF9 protein (Active) spans the amino acid sequence from region 2-208aa. Purity: > 95% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

FGF-9, GAF, Heparin-binding growth factor 9, HBGF-9

UniProt

P31371

Expression Region

2-208aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 95% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by thymidine uptake assay using FGF-receptors transfected BaF3 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 x 10 ^ 6 IU/mg.

Form

Lyophilized powder

Molecular Weight

23.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

APLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALKBH3 AAV siRNA Pooled Vector
11774161 1.0 µg

ALKBH3 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
1,5-Dihydroxy-1,2,3,4-tetrahydronaphthalene
QBA77126 2.5 g

1,5-Dihydroxy-1,2,3,4-tetrahydronaphthalene

Sign In for Pricing
View Details
SFRS12 (SREK1) (NM_139168) Human Tagged Lenti ORF Clone
RC222671L1 10 µg

SFRS12 (SREK1) (NM_139168) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Lentiviral mouse Zfand1 shRNA (UAS) - Lentiviral mouse Zfand1 shRNA (UAS, GFP) (100)
GTR15280509 1 Vial

Lentiviral mouse Zfand1 shRNA (UAS) - Lentiviral mouse Zfand1 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
TM222, ID (TMEM222, C1orf160, Transmembrane protein 222) (APC)
MBS6356032-01 0.2 mL

TM222, ID (TMEM222, C1orf160, Transmembrane protein 222) (APC)

Sign In for Pricing
View Details
TM222, ID (TMEM222, C1orf160, Transmembrane protein 222) (APC)
MBS6356032-02 5x 0.2 mL

TM222, ID (TMEM222, C1orf160, Transmembrane protein 222) (APC)

Sign In for Pricing
View Details