Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FGF1 protein (Active)

This Human FGF1 protein (Active) spans the amino acid sequence from region 16-155aa. Purity: > 95% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

FGF-1, aFGF, Endothelial cell growth factor, ECGF, Heparin-binding growth factor 1

UniProt

P05230

Expression Region

16-155aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 95% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine balb/c 3T3 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 x 10 ^ 6 IU/mg in the presence of 10 μg/ml of heparin.

Form

Lyophilized powder

Molecular Weight

16.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

M+FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTR3B Protein Vector (Human) (pPB-His-MBP)
PV319586 500 ng

ACTR3B Protein Vector (Human) (pPB-His-MBP)

Sign In for Pricing
View Details
Porcine Aryl hydrocarbon receptor repressor (AHRR) ELISA Kit
MBS7249936-01 48 Well

Porcine Aryl hydrocarbon receptor repressor (AHRR) ELISA Kit

Sign In for Pricing
View Details
Porcine Aryl hydrocarbon receptor repressor (AHRR) ELISA Kit
MBS7249936-02 96 Well

Porcine Aryl hydrocarbon receptor repressor (AHRR) ELISA Kit

Sign In for Pricing
View Details
Porcine Aryl hydrocarbon receptor repressor (AHRR) ELISA Kit
MBS7249936-03 5x 96 Well

Porcine Aryl hydrocarbon receptor repressor (AHRR) ELISA Kit

Sign In for Pricing
View Details
Porcine Aryl hydrocarbon receptor repressor (AHRR) ELISA Kit
MBS7249936-04 10x 96 Well

Porcine Aryl hydrocarbon receptor repressor (AHRR) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human ANKRD13A
orb1099425-01 50 µg

Recombinant Human ANKRD13A

Sign In for Pricing
View Details