Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ONCM protein (Active)

This Human ONCM protein (Active) spans the amino acid sequence from region 26-234aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

OSM

UniProt

P13725

Expression Region

26-234aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 2 ng/ml, corresponding to a specific activity of > 5.0 x 10 ^ 5 IU/mg.

Form

Lyophilized powder

Molecular Weight

23.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIAA0802 (MTCL1) (NM_015210) Human Untagged Clone
SC304258 10 µg

KIAA0802 (MTCL1) (NM_015210) Human Untagged Clone

Sign In for Pricing
View Details
Dennd4c Goat Polyclonal Antibody
TA311611 100 µg

Dennd4c Goat Polyclonal Antibody

Sign In for Pricing
View Details
Foxd2 Antibody - C-terminal region : HRP (ARP36925_P050-HRP)
ARP36925_P050-HRP 100 µL

Foxd2 Antibody - C-terminal region : HRP (ARP36925_P050-HRP)

Sign In for Pricing
View Details
IGSF1 Rabbit Polyclonal Antibody (Biotin)
orb2122918 100 µL

IGSF1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
SNU-324
CSC-C9662L One Frozen Vial

SNU-324

Sign In for Pricing
View Details
ZNF313, CT (RNF114, ZNF228, ZNF313, RING finger protein 114, Zinc finger protein 228, Zinc finger protein 313) (MaxLight 405)
MBS6366156-01 0.1 mL

ZNF313, CT (RNF114, ZNF228, ZNF313, RING finger protein 114, Zinc finger protein 228, Zinc finger protein 313) (MaxLight 405)

Sign In for Pricing
View Details