Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ONCM protein (Active)

This Human ONCM protein (Active) spans the amino acid sequence from region 26-234aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

OSM

UniProt

P13725

Expression Region

26-234aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 2 ng/ml, corresponding to a specific activity of > 5.0 x 10 ^ 5 IU/mg.

Form

Lyophilized powder

Molecular Weight

23.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Corralin Soda Reagent Solution
0876B 00500 500 mL

Corralin Soda Reagent Solution

Sign In for Pricing
View Details
LOC171573 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV659358 1.0 µg DNA

LOC171573 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
PHF20L1 Mouse Monoclonal Antibody [Clone ID: OTI1B4]
TA809758 100 µL

PHF20L1 Mouse Monoclonal Antibody [Clone ID: OTI1B4]

Sign In for Pricing
View Details
Rabbit Polyclonal CEBP Delta Antibody [CoraFluor 1]
NB110-85519CL1 0.1 mL

Rabbit Polyclonal CEBP Delta Antibody [CoraFluor 1]

Sign In for Pricing
View Details
Clec16a sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4543406 1.0 µg DNA

Clec16a sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Rictor Rabbit Polyclonal Antibody
orb512708 100 µg

Rictor Rabbit Polyclonal Antibody

Sign In for Pricing
View Details