Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Monkey IL8 protein (Active)

This Monkey IL8 protein (Active) spans the amino acid sequence from region 23-101aa. Purity: > 95% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

310C protein, 9E3 protein, AMCF1 protein, CEF-4 protein, chemokine, CXC motif, ligand 8 protein, CXC chemokine ligand 8 protein, CXC chemokine ligand 8 protein, CXCL 8 protein, Emoctakin protein, GCP 1 protein, GCP-1 protein, GCP1 protein, Granulocyte chemotactic protein 1 protein, IL 8 protein, IL8/NAP1 form I protein, Inteleukin 8 protein, Interleukin8 protein, K60 protein, LECT protein, LECT protein, LYNAP protein, MDNCF protein, Monocyte derived neutrophil activating peptide protein, NAF protein, NAP 1 protein, Neutrophil activating factor protein, Neutrophil activating factor protein, Neutrophil activating peptide 1 protein, SCYB8 protein, T-cell chemotactic factor protein, TSG1 protein

UniProt

P67813

Expression Region

23-101aa

Tag

Tag-Free

Source

E.Coli

Origin

Macaca mulatta (Rhesus macaque)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 95% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human CXCR2 transfected murine BaF3 cells is in a concentration range of 0.5-5.0 ng/ml.

Form

Lyophilized powder

Molecular Weight

9.14 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

AVLPRSAKELRCECIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKEPWVQRVVEKFVKRAENQNP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR1F1, CT (OR1F1, OLFMF, OR1F10, OR1F4, OR1F5, OR1F6, OR1F7, OR1F8, OR1F9, Olfactory receptor 1F1, Olfactory receptor 16-35, Olfactory receptor 1F10, Olfactory receptor 1F4, Olfactory receptor 1F5, Olfactory receptor 1F6, Olfactory receptor 1F7, Olfactory receptor 1F8, Olfactory receptor 1F9, Olfactory receptor OR16-4) (Biotin) discontinued
039333-Biotin 200 µL

OR1F1, CT (OR1F1, OLFMF, OR1F10, OR1F4, OR1F5, OR1F6, OR1F7, OR1F8, OR1F9, Olfactory receptor 1F1, Olfactory receptor 16-35, Olfactory receptor 1F10, Olfactory receptor 1F4, Olfactory receptor 1F5, Olfactory receptor 1F6, Olfactory receptor 1F7, Olfactory receptor 1F8, Olfactory receptor 1F9, Olfactory receptor OR16-4) (Biotin) discontinued

Sign In for Pricing
View Details
14-3-3 beta, alpha, CT (Protein 1054, Protein Kinase C Inhibitor Protein 1, KCIP-1, 14-3-3 Protein beta/alpha, N-terminally Processed, YWHAB) (AP) discontinued
0014-02L-AP 200 µL

14-3-3 beta, alpha, CT (Protein 1054, Protein Kinase C Inhibitor Protein 1, KCIP-1, 14-3-3 Protein beta/alpha, N-terminally Processed, YWHAB) (AP) discontinued

Sign In for Pricing
View Details
Human Heat shock protein beta-6,HSPB6 ELISA KIT
JOT-EK5379Hu-01 48 Well

Human Heat shock protein beta-6,HSPB6 ELISA KIT

Sign In for Pricing
View Details
Human Heat shock protein beta-6,HSPB6 ELISA KIT
JOT-EK5379Hu-02 96 Well

Human Heat shock protein beta-6,HSPB6 ELISA KIT

Sign In for Pricing
View Details
PAH Rabbit Polyclonal Antibody (Biotin)
orb2615121 100 µg

PAH Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
2-[Hydroxy (methyl) phosphoryl]benzoic acid
FCA91857-01 50 mg

2-[Hydroxy (methyl) phosphoryl]benzoic acid

Sign In for Pricing
View Details