Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Q5PPP2 protein (Active)

This Rat Q5PPP2 protein (Active) spans the amino acid sequence from region 23-119aa. Purity: > 96% as determined by SDS-PAGE and HPLC.

Product Specifications

UniProt

Q5PPP2

Expression Region

23-119aa

Tag

Tag-Free

Source

E.Coli

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 96% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biologically active determined by a chemotaxis bioassay using human peripheral blood eosinophils is in a concentration of 50-250 ng/ml.

Form

Lyophilized powder

Molecular Weight

10.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

M+PTGSVTIPSSCCVTFISKKIPVNRVISYQLANGSICPKAGVIFITKKGHKICTDPKLPWVQKHIKNLDAKRNQPSEGAKALGPKFVIQKLRGNSTKV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P2RX3 Rabbit pAb
A10232 200 µL

P2RX3 Rabbit pAb

Sign In for Pricing
View Details
USP22 CRISPR Activation Plasmid (m2)
sc-432127-ACT-2 20 µg

USP22 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
EYA1 Lentiviral Activation Particles (m)
sc-420254-LAC 200 µL

EYA1 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Recombinant Mycoplasma capricolum subsp. capricolum DNA repair protein recO (recO)
MBS1358308-01 0.02 mg (E-Coli)

Recombinant Mycoplasma capricolum subsp. capricolum DNA repair protein recO (recO)

Sign In for Pricing
View Details
Recombinant Mycoplasma capricolum subsp. capricolum DNA repair protein recO (recO)
MBS1358308-02 0.1 mg (E-Coli)

Recombinant Mycoplasma capricolum subsp. capricolum DNA repair protein recO (recO)

Sign In for Pricing
View Details
Recombinant Mycoplasma capricolum subsp. capricolum DNA repair protein recO (recO)
MBS1358308-03 0.02 mg (Yeast)

Recombinant Mycoplasma capricolum subsp. capricolum DNA repair protein recO (recO)

Sign In for Pricing
View Details