Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Q9QZU1 protein (Active)

This Rat Q9QZU1 protein (Active) spans the amino acid sequence from region 14-81aa. Purity: > 96% as determined by SDS-PAGE and HPLC.

Product Specifications

UniProt

Q9QZU1

Expression Region

14-81aa

Tag

Tag-Free

Source

E.Coli

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 96% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biologically active determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration range of 10-100 ng/ml.

Form

Lyophilized powder

Molecular Weight

7.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

GPYGANVEDSICCQDYIRHPLPPRFVKEFYWTSKSCRKPGVVLITIKNRDICADPRMLWVKKILHKLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Integrin alpha 5 (ITGA5) Human Knockdown Lysate
LY300213 100 µg

Integrin alpha 5 (ITGA5) Human Knockdown Lysate

Sign In for Pricing
View Details
Human GRRP1 (FAM110D) activation kit by CRISPRa
GA112735 1 Kit

Human GRRP1 (FAM110D) activation kit by CRISPRa

Sign In for Pricing
View Details
IFluor® 790 acid
1360-AAT 5 mg

IFluor® 790 acid

Sign In for Pricing
View Details
FOXC1 Recombinant Rabbit Monoclonal Antibody [PSH03-89]
HA722060 100 µL

FOXC1 Recombinant Rabbit Monoclonal Antibody [PSH03-89]

Sign In for Pricing
View Details
High Sensitivity Mouse IL-17A (Interleukin 17A) ELISA Kit
E-HSEL-M0005-01 24 Tests

High Sensitivity Mouse IL-17A (Interleukin 17A) ELISA Kit

Sign In for Pricing
View Details
High Sensitivity Mouse IL-17A (Interleukin 17A) ELISA Kit
E-HSEL-M0005-02 48 Tests

High Sensitivity Mouse IL-17A (Interleukin 17A) ELISA Kit

Sign In for Pricing
View Details