Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Q9QZU1 protein (Active)

This Rat Q9QZU1 protein (Active) spans the amino acid sequence from region 14-81aa. Purity: > 96% as determined by SDS-PAGE and HPLC.

Product Specifications

UniProt

Q9QZU1

Expression Region

14-81aa

Tag

Tag-Free

Source

E.Coli

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 96% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biologically active determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration range of 10-100 ng/ml.

Form

Lyophilized powder

Molecular Weight

7.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

GPYGANVEDSICCQDYIRHPLPPRFVKEFYWTSKSCRKPGVVLITIKNRDICADPRMLWVKKILHKLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

B7H4 (VTCN1) (153-165) Goat Polyclonal Antibody
AP31843PU-N 100 µg

B7H4 (VTCN1) (153-165) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse Fibroblast Growth Factor 21/FGF-21 (C-6His)
PKSM041418-01 10 µg

Recombinant Mouse Fibroblast Growth Factor 21/FGF-21 (C-6His)

Sign In for Pricing
View Details
Recombinant Mouse Fibroblast Growth Factor 21/FGF-21 (C-6His)
PKSM041418-02 50 µg

Recombinant Mouse Fibroblast Growth Factor 21/FGF-21 (C-6His)

Sign In for Pricing
View Details
Semaphorin 5A (SEMA5A) (N-term) Rabbit Polyclonal Antibody
AP12324PU-N 400 µL

Semaphorin 5A (SEMA5A) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Apigenin
SIH-249-10MG 10 mg

Apigenin

Sign In for Pricing
View Details
2-Amino-5-chlorobenzophenone Oxime-d5
TRC-A603732-50MG 50 mg

2-Amino-5-chlorobenzophenone Oxime-d5

Sign In for Pricing
View Details