Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Q9ERE0 protein (Active)

This Rat Q9ERE0 protein (Active) spans the amino acid sequence from region 24-93aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

UniProt

Q9ERE0

Expression Region

24-93aa

Tag

Tag-Free

Source

E.Coli

Origin

Rattus norvegicus (Rat)

Field of Research

Signal Transduction

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration range of 1.0-10 ng/ml.

Form

Lyophilized powder

Molecular Weight

8.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

ARATNVGRECCLDYFKGAIPIRKLVTWFRTSVECPKDAIVFETVQGRLICTDPKDKHVKKAIRHLKNQRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human NGAL/Lipocalin-2 Protein (His Tag, Human Cells)
PKSH032806-01 10 µg

Recombinant Human NGAL/Lipocalin-2 Protein (His Tag, Human Cells)

Sign In for Pricing
View Details
Recombinant Human NGAL/Lipocalin-2 Protein (His Tag, Human Cells)
PKSH032806-02 50 µg

Recombinant Human NGAL/Lipocalin-2 Protein (His Tag, Human Cells)

Sign In for Pricing
View Details
GATA-3 (Breast and Urothelial Marker) (GATA3/2444), CF740 conjugate, 0.1mg/mL
BNC742444-500 1x 500 µL

GATA-3 (Breast and Urothelial Marker) (GATA3/2444), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BstENI, 100U
RE1216 100 U

BstENI, 100U

Sign In for Pricing
View Details
MANEA Polyclonal Antibody
E-AB-90243-01 60 µL

MANEA Polyclonal Antibody

Sign In for Pricing
View Details
MANEA Polyclonal Antibody
E-AB-90243-02 120 µL

MANEA Polyclonal Antibody

Sign In for Pricing
View Details