Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat CCL11 protein (Active)

This Rat CCL11 protein (Active) spans the amino acid sequence from region 24-97aa. Purity: > 96% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

C-C motif chemokine 11, Small-inducible cytokine A11

UniProt

P97545

Expression Region

24-97aa

Tag

Tag-Free

Source

E.Coli

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 96% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using purified eosinophils is in a concentration range of 0.1-1.0 μg/ml.

Form

Lyophilized powder

Molecular Weight

8.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

HPGSIPTSCCFTMTSKKIPNTLLKSYKRITNNRCTLKAIVFKTKLGKEICADPKKKWVQDATKHLDQKLQTPKP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C12orf48 3'UTR GFP Stable Cell Line
TU052812 1.0 mL

C12orf48 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
CCL25 siRNA (Human)
MBS8207116-01 15 nmol

CCL25 siRNA (Human)

Sign In for Pricing
View Details
CCL25 siRNA (Human)
MBS8207116-02 30 nmol

CCL25 siRNA (Human)

Sign In for Pricing
View Details
CCL25 siRNA (Human)
MBS8207116-03 5x 30 nmol

CCL25 siRNA (Human)

Sign In for Pricing
View Details
Anti-S6K1 Rabbit pAb
GB111133 100 μL

Anti-S6K1 Rabbit pAb

Sign In for Pricing
View Details
Recombinant Methanothermobacter thermautotrophicus Putative biopolymer transport protein exbB homolog (MTH_1022)
orb2927424-01 20 µg

Recombinant Methanothermobacter thermautotrophicus Putative biopolymer transport protein exbB homolog (MTH_1022)

Sign In for Pricing
View Details