Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat CCL7 protein (Active)

This Rat CCL7 protein (Active) spans the amino acid sequence from region 24-97aa. Purity: > 95% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Monocyte chemoattractant protein 3, MCP-3, Small-inducible cytokine A7

UniProt

Q9QXY8

Expression Region

24-97aa

Tag

Tag-Free

Source

E.Coli

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 95% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biologically active determined by a chemotaxis bioassay using human monocytes is in a concentration range of 10-100 ng/ml.

Form

Lyophilized powder

Molecular Weight

8.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

QPDGTNSSTCCYVKKQKIPKRNLKSYRKITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTSTPKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc22a27 (NM_134256) Mouse Untagged Clone
MC218874 10 µg

Slc22a27 (NM_134256) Mouse Untagged Clone

Sign In for Pricing
View Details
Streptococcus agalactiae CYK3/IgdE3 Polyclonal Antibody
E55A05285 100 µg

Streptococcus agalactiae CYK3/IgdE3 Polyclonal Antibody

Sign In for Pricing
View Details
Human Cytochrome P450 2C19 (CYP2C19) ELISA Kit
MBS2097896-01 24 Strip Well

Human Cytochrome P450 2C19 (CYP2C19) ELISA Kit

Sign In for Pricing
View Details
Human Cytochrome P450 2C19 (CYP2C19) ELISA Kit
MBS2097896-02 48 Well

Human Cytochrome P450 2C19 (CYP2C19) ELISA Kit

Sign In for Pricing
View Details
Human Cytochrome P450 2C19 (CYP2C19) ELISA Kit
MBS2097896-03 96 Well

Human Cytochrome P450 2C19 (CYP2C19) ELISA Kit

Sign In for Pricing
View Details
Human Cytochrome P450 2C19 (CYP2C19) ELISA Kit
MBS2097896-04 5x 96 Well

Human Cytochrome P450 2C19 (CYP2C19) ELISA Kit

Sign In for Pricing
View Details