Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat CCL6 protein (Active)

This Rat CCL6 protein (Active) spans the amino acid sequence from region 22-115aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Small-inducible cytokine A6

UniProt

Q68FP3

Expression Region

22-115aa

Tag

Tag-Free

Source

E.Coli

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human CCR1 transfected murine BaF3 cells is in a concentration range of 10-100 ng/ml.

Form

Lyophilized powder

Molecular Weight

10.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

GLIQDTVKEDRPFNPTIIHQGFQDSSDCCFSYASQIPCSRFIYYFPTSGGCTKPGIIFVTRKRKRVCANPSDQRVQTCISTLKLGPRSGNSAIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human SIRPG shRNA (UAS) - Lentiviral human SIRPG shRNA (UAS, RFP) (100)
GTR15313479 1 Vial

Lentiviral human SIRPG shRNA (UAS) - Lentiviral human SIRPG shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
PLV3-CMV-Ssh1-3xFLAG-CopGFP-Puro Plasmid
PVT67806 2 µg

PLV3-CMV-Ssh1-3xFLAG-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
TSHB (Thyrotropin Subunit beta, Thyroid-stimulating Hormone Subunit beta, TSH-B, TSH-beta, Thyrotropin beta Chain, Thyrotropin alfa) (PE)
MBS6125968-01 0.1 mL

TSHB (Thyrotropin Subunit beta, Thyroid-stimulating Hormone Subunit beta, TSH-B, TSH-beta, Thyrotropin beta Chain, Thyrotropin alfa) (PE)

Sign In for Pricing
View Details
TSHB (Thyrotropin Subunit beta, Thyroid-stimulating Hormone Subunit beta, TSH-B, TSH-beta, Thyrotropin beta Chain, Thyrotropin alfa) (PE)
MBS6125968-02 5x 0.1 mL

TSHB (Thyrotropin Subunit beta, Thyroid-stimulating Hormone Subunit beta, TSH-B, TSH-beta, Thyrotropin beta Chain, Thyrotropin alfa) (PE)

Sign In for Pricing
View Details
CYP4A22 Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-5055R-APC-Cy5.5 100 µL

CYP4A22 Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
Adipocyte plasma membrane-associated protein
orb1644032-01 50 µg

Adipocyte plasma membrane-associated protein

Sign In for Pricing
View Details