Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat CCL3 protein (Active)

This Rat CCL3 protein (Active) spans the amino acid sequence from region 24-92aa. Purity: > 98% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Macrophage inflammatory protein 1-alpha, Small-inducible cytokine A3

UniProt

P50229

Expression Region

24-92aa

Tag

Tag-Free

Source

E.Coli

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 98% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemoattract bioassay using human blood monocytes is in a concentration range of 10-100 ng/ml.

Form

Lyophilized powder

Molecular Weight

7.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered concentrated solution in 30 % Acetonitrile and 0.1 % TFA.

AA Sequence

APYGADTPTACCFSYGRQIPRKFIADYFETSSLCSQPGVIFLTKRNRQICADPKETWVQEYITELELNA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSTM2 Recombinant Protein (Human)
RP039664 100 µg

GSTM2 Recombinant Protein (Human)

Sign In for Pricing
View Details
Manganese chloride (tetrahydrate)
orb2942438-01 5 g

Manganese chloride (tetrahydrate)

Sign In for Pricing
View Details
Manganese chloride (tetrahydrate)
orb2942438-02 10 g

Manganese chloride (tetrahydrate)

Sign In for Pricing
View Details
Manganese chloride (tetrahydrate)
orb2942438-03 25 g

Manganese chloride (tetrahydrate)

Sign In for Pricing
View Details
Dnmt1, phosphorylated (S1105) (DNMT1, AIM, CXXC9, DNMT, DNA (cytosine-5) -methyltransferase 1, CXXC-type zinc finger protein 9, DNA methyltransferase HsaI, MCMT) (Biotin) discontinued
034740-Biotin 200 µL

Dnmt1, phosphorylated (S1105) (DNMT1, AIM, CXXC9, DNMT, DNA (cytosine-5) -methyltransferase 1, CXXC-type zinc finger protein 9, DNA methyltransferase HsaI, MCMT) (Biotin) discontinued

Sign In for Pricing
View Details
Esculentoside E
T124459-01 1 mg

Esculentoside E

Sign In for Pricing
View Details