Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Q8K453 protein (Active)

This Rat Q8K453 protein (Active) spans the amino acid sequence from region 23-99aa. Purity: > 95% as determined by SDS-PAGE and HPLC.

Product Specifications

UniProt

Q8K453

Expression Region

23-99aa

Tag

Tag-Free

Source

E.Coli

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 95% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 1.0-10 ng/ml.

Form

Lyophilized powder

Molecular Weight

9.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSMSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIR3179-3 ORF Vector (Human) (pORF)
ORF023990 1.0 µg DNA

MIR3179-3 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
AdmiRa-mmu-miR-323-5p-Off Virus
mm5587 1.0 mL

AdmiRa-mmu-miR-323-5p-Off Virus

Sign In for Pricing
View Details
APEX1 (DNA- (Apurinic or Apyrimidinic Site) Lyase)
475401 100 µL

APEX1 (DNA- (Apurinic or Apyrimidinic Site) Lyase)

Sign In for Pricing
View Details
Lentiviral human NFIL3 shRNA (UAS) - Lentiviral human NFIL3 shRNA (UAS, RFP) plasmid
GTR15107653 1 Vial

Lentiviral human NFIL3 shRNA (UAS) - Lentiviral human NFIL3 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Nori® Mouse IGFBP-6 BPa ELISA Kit
GR117047 96 Well

Nori® Mouse IGFBP-6 BPa ELISA Kit

Sign In for Pricing
View Details
CAMK2 Delta, Recombinant, Human, GST-Tag (Calcium/Calmodulin-Dependent Protein Kinase II delta, CAMKD, MGC44911) discontinued
499842 10 µg

CAMK2 Delta, Recombinant, Human, GST-Tag (Calcium/Calmodulin-Dependent Protein Kinase II delta, CAMKD, MGC44911) discontinued

Sign In for Pricing
View Details