Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Q9QZD1 protein (Active)

This Rat Q9QZD1 protein (Active) spans the amino acid sequence from region 22-89aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

SDF-1

UniProt

Q9QZD1

Expression Region

22-89aa

Tag

Tag-Free

Source

E.Coli

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood monocytes is in a concentration range of 100-200 ng/ml.

Form

Lyophilized powder

Molecular Weight

8.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKSNNRQVCIDPKLKWIQEYLDKALNK+RLKM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mycoplasma pneumoniae Uncharacterized protein MPN_035 (MPN_035), partial
MBS1096574 Inquire

Recombinant Mycoplasma pneumoniae Uncharacterized protein MPN_035 (MPN_035), partial

Sign In for Pricing
View Details
hsa-miR-6792-3p miRNA Mimic
MBS8300295-01 5 nmol

hsa-miR-6792-3p miRNA Mimic

Sign In for Pricing
View Details
hsa-miR-6792-3p miRNA Mimic
MBS8300295-02 10 nmol

hsa-miR-6792-3p miRNA Mimic

Sign In for Pricing
View Details
hsa-miR-6792-3p miRNA Mimic
MBS8300295-03 5x 10 nmol

hsa-miR-6792-3p miRNA Mimic

Sign In for Pricing
View Details
Suc-Ala-Ala-Pro-Ala-pNA
4015680.0250 250 mg

Suc-Ala-Ala-Pro-Ala-pNA

Sign In for Pricing
View Details
Med13l Mouse siRNA Oligo Duplex (Locus ID 76199)
SR423430 1 Kit

Med13l Mouse siRNA Oligo Duplex (Locus ID 76199)

Sign In for Pricing
View Details