Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Q99ME0 protein (Active)

This Rat Q99ME0 protein (Active) spans the amino acid sequence from region 46-107aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Cxcl7 Rtck1

UniProt

Q99ME0

Expression Region

46-107aa

Tag

Tag-Free

Source

E.Coli

Origin

Rattus norvegicus (Rat)

Field of Research

Signal Transduction

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biologically active determined by a chemotaxis bioassay using human CXCR2 transfected murine BaF3 cells is in a concentration range of 0.1-1.0 ng/ml.

Form

Lyophilized powder

Molecular Weight

6.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

IELRCRCTNTLSGIPLNSISRVNVFRPGAHCDNVEVIATLKNGKEVCLDPTAPMIKKIVKKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fehling's Solution B
40220110-3 4 L

Fehling's Solution B

Sign In for Pricing
View Details
Deoxyguanosine kinase (DGUOK) (NM_080916) Human Recombinant Protein
E45H39604M5 20 µg

Deoxyguanosine kinase (DGUOK) (NM_080916) Human Recombinant Protein

Sign In for Pricing
View Details
AR Alpha2A Polyclonal Antibody
BT-AP00570-01 20 µL

AR Alpha2A Polyclonal Antibody

Sign In for Pricing
View Details
AR Alpha2A Polyclonal Antibody
BT-AP00570-02 50 µL

AR Alpha2A Polyclonal Antibody

Sign In for Pricing
View Details
AR Alpha2A Polyclonal Antibody
BT-AP00570-03 100 µL

AR Alpha2A Polyclonal Antibody

Sign In for Pricing
View Details
NDUFA13 Antibody - N-terminal region : Biotin (ARP75565_P050-Biotin)
ARP75565_P050-Biotin 100 µL

NDUFA13 Antibody - N-terminal region : Biotin (ARP75565_P050-Biotin)

Sign In for Pricing
View Details