Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Q99ME0 protein (Active)

This Rat Q99ME0 protein (Active) spans the amino acid sequence from region 46-107aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Cxcl7 Rtck1

UniProt

Q99ME0

Expression Region

46-107aa

Tag

Tag-Free

Source

E.Coli

Origin

Rattus norvegicus (Rat)

Field of Research

Signal Transduction

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biologically active determined by a chemotaxis bioassay using human CXCR2 transfected murine BaF3 cells is in a concentration range of 0.1-1.0 ng/ml.

Form

Lyophilized powder

Molecular Weight

6.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

IELRCRCTNTLSGIPLNSISRVNVFRPGAHCDNVEVIATLKNGKEVCLDPTAPMIKKIVKKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olanexidine HCl
MBS5777922 Inquire

Olanexidine HCl

Sign In for Pricing
View Details
HS2ST1 Rabbit Polyclonal Antibody (HRP)
orb2114012 100 µL

HS2ST1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
MED28 Recombinant Protein Antigen
NBP2-38271PEP 0.1 mL

MED28 Recombinant Protein Antigen

Sign In for Pricing
View Details
RELN Polyclonal Antibody
JOT-AP13656-01 20 µL

RELN Polyclonal Antibody

Sign In for Pricing
View Details
RELN Polyclonal Antibody
JOT-AP13656-02 50 μL

RELN Polyclonal Antibody

Sign In for Pricing
View Details
RELN Polyclonal Antibody
JOT-AP13656-03 100 µL

RELN Polyclonal Antibody

Sign In for Pricing
View Details