Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat CXCL2 protein (Active)

This Rat CXCL2 protein (Active) spans the amino acid sequence from region 28-100aa. Purity: > 98% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Cytokine-induced neutrophil chemoattractant 3, Macrophage inflammatory protein 2, MIP2

UniProt

P30348

Expression Region

28-100aa

Tag

Tag-Free

Source

E.Coli

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 98% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using rat neutrophils is in a concentration range of 10-100 ng/ml.

Form

Lyophilized powder

Molecular Weight

7.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

VVVASELRCQCLTTLPRVDFKNIQSLTVTPPGPHCAQTEVIATLKDGHEVCLNPEAPLVQRIVQKILNKGKAN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Aeromonas Hydrophila rplV Protein
VAng-Lsx0773-500gEcoli 500 µg (E. coli)

Recombinant Aeromonas Hydrophila rplV Protein

Sign In for Pricing
View Details
SMYD2 Polyclonal Antibody
MBS2537037-01 0.02 mL

SMYD2 Polyclonal Antibody

Sign In for Pricing
View Details
SMYD2 Polyclonal Antibody
MBS2537037-02 0.06 mL

SMYD2 Polyclonal Antibody

Sign In for Pricing
View Details
SMYD2 Polyclonal Antibody
MBS2537037-03 0.12 mL

SMYD2 Polyclonal Antibody

Sign In for Pricing
View Details
SMYD2 Polyclonal Antibody
MBS2537037-04 0.2 mL

SMYD2 Polyclonal Antibody

Sign In for Pricing
View Details
RSU1 Polyclonal Antibody
ANT-14240-100ug 100 µg

RSU1 Polyclonal Antibody

Sign In for Pricing
View Details