Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat CXCL2 protein (Active)

This Rat CXCL2 protein (Active) spans the amino acid sequence from region 28-100aa. Purity: > 98% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Cytokine-induced neutrophil chemoattractant 3, Macrophage inflammatory protein 2, MIP2

UniProt

P30348

Expression Region

28-100aa

Tag

Tag-Free

Source

E.Coli

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 98% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using rat neutrophils is in a concentration range of 10-100 ng/ml.

Form

Lyophilized powder

Molecular Weight

7.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

VVVASELRCQCLTTLPRVDFKNIQSLTVTPPGPHCAQTEVIATLKDGHEVCLNPEAPLVQRIVQKILNKGKAN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

E030019B06Rik Double Nickase Plasmid (m)
sc-431782-NIC 20 µg

E030019B06Rik Double Nickase Plasmid (m)

Sign In for Pricing
View Details
RAP1GDS1, ID (RAP1GDS1, Rap1 GTPase-GDP dissociation stimulator 1, Exchange factor smgGDS, SMG GDS protein, SMG P21 stimulatory GDP/GTP exchange protein) (APC) discontinued
040830-APC 200 µL

RAP1GDS1, ID (RAP1GDS1, Rap1 GTPase-GDP dissociation stimulator 1, Exchange factor smgGDS, SMG GDS protein, SMG P21 stimulatory GDP/GTP exchange protein) (APC) discontinued

Sign In for Pricing
View Details
Recombinant Human Hsp22
11133P-10 10ug

Recombinant Human Hsp22

Sign In for Pricing
View Details
DSG1 (Desmoglein-1, Cadherin Family Member 4, Desmosomal Glycoprotein 1, DG1, DGI, Pemphigus Foliaceus Antigen, CDHF4) (HRP)
126031-HRP 100 µL

DSG1 (Desmoglein-1, Cadherin Family Member 4, Desmosomal Glycoprotein 1, DG1, DGI, Pemphigus Foliaceus Antigen, CDHF4) (HRP)

Sign In for Pricing
View Details
MESDC2 Protein, Human, Recombinant (His Tag)
PH51253M2 100 µg

MESDC2 Protein, Human, Recombinant (His Tag)

Sign In for Pricing
View Details
Projection Slides Health Rules
4050100/1 1 Each

Projection Slides Health Rules

Sign In for Pricing
View Details