Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat GROA protein (Active)

This Rat GROA protein (Active) spans the amino acid sequence from region 25-96aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

C-X-C motif chemokine 1, CINC-1, Platelet-derived growth factor-inducible protein KC

UniProt

P14095

Expression Region

25-96aa

Tag

Tag-Free

Source

E.Coli

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using rat neutrophils is in a concentration range of 10-100 ng/ml.

Form

Lyophilized powder

Molecular Weight

7.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

APVANELRCQCLQTVAGIHFKNIQSLKVMPPGPHCTQTEVIATLKNGREACLDPEAPMVQKIVQKMLKGVPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAPK1 Antibody
OAAJ06506-100UL 100 µL

MAPK1 Antibody

Sign In for Pricing
View Details
PIKFYVE CRISPR Knock Out 293T Cell Line (Human)
36691141 1x 10^6 Cells / 1.0 mL

PIKFYVE CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Anti-Mouse CD200 Polyclonal Antibody
PME30301 100 μg

Anti-Mouse CD200 Polyclonal Antibody

Sign In for Pricing
View Details
TCP11L2 Antibody
27-043 100 µL

TCP11L2 Antibody

Sign In for Pricing
View Details
OR4N2 Peptide - C-terminal region
MBS3243627-01 0.1 mg

OR4N2 Peptide - C-terminal region

Sign In for Pricing
View Details
OR4N2 Peptide - C-terminal region
MBS3243627-02 5x 0.1 mg

OR4N2 Peptide - C-terminal region

Sign In for Pricing
View Details