Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat GROA protein (Active)

This Rat GROA protein (Active) spans the amino acid sequence from region 25-96aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

C-X-C motif chemokine 1, CINC-1, Platelet-derived growth factor-inducible protein KC

UniProt

P14095

Expression Region

25-96aa

Tag

Tag-Free

Source

E.Coli

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using rat neutrophils is in a concentration range of 10-100 ng/ml.

Form

Lyophilized powder

Molecular Weight

7.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

APVANELRCQCLQTVAGIHFKNIQSLKVMPPGPHCTQTEVIATLKNGREACLDPEAPMVQKIVQKMLKGVPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dutp (BC019979) Mouse Tagged Lenti ORF Clone
MR202022L3 10 µg

Dutp (BC019979) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mouse Monoclonal YB1 Antibody (OTI7B4) [DyLight 350]
NBP2-74905UV 0.1 mL

Mouse Monoclonal YB1 Antibody (OTI7B4) [DyLight 350]

Sign In for Pricing
View Details
BC030290 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV812250 1.0 µg DNA

BC030290 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
EGFL6 Protein Vector (Human) (pPB-N-His)
PV013718 500 ng

EGFL6 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
CYP2A7 Rabbit Polyclonal Antibody
orb578218 100 µL

CYP2A7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Claudin 23 (CLDN23) (NM_194284) Human Tagged ORF Clone
RG221232 10 µg

Claudin 23 (CLDN23) (NM_194284) Human Tagged ORF Clone

Sign In for Pricing
View Details