Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse CCL25 protein (Active)

This Mouse CCL25 protein (Active) spans the amino acid sequence from region 24-144aa. Purity: > 95% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Chemokine TECK, Thymus-expressed chemokine

UniProt

O35903

Expression Region

24-144aa

Tag

Tag-Free

Source

E.Coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 95% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 5.0-50 ng/ml.

Form

Lyophilized powder

Molecular Weight

14.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

QGAFEDCCLGYQHRIKWNVLRHARNYHQQEVSGSCNLRAVRFYFRQKVVCGNPEDMNVKRAIRILTARKRLVHWKSASDSQTERKKSNHMKSKVENPNSTSVRSATLGHPRMVMMPRKTNN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CD114 protein, C-His Tag
MBS1560569-01 0.05 mg

Recombinant Human CD114 protein, C-His Tag

Sign In for Pricing
View Details
Recombinant Human CD114 protein, C-His Tag
MBS1560569-02 0.1 mg

Recombinant Human CD114 protein, C-His Tag

Sign In for Pricing
View Details
Recombinant Human CD114 protein, C-His Tag
MBS1560569-03 5x 0.1 mg

Recombinant Human CD114 protein, C-His Tag

Sign In for Pricing
View Details
RGL2 Antibody
orb1315477 100 µL

RGL2 Antibody

Sign In for Pricing
View Details
RPL32P7 AAV siRNA Pooled Vector
41445161 1.0 µg

RPL32P7 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
FAM50A Recombinant Rabbit mAb
orb2325821-01 25 µL

FAM50A Recombinant Rabbit mAb

Sign In for Pricing
View Details