Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse CCL24 protein (Active)

This Mouse CCL24 protein (Active) spans the amino acid sequence from region 27-119aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Eosinophil chemotactic protein 2, Small-inducible cytokine A24

UniProt

Q9JKC0

Expression Region

27-119aa

Tag

Tag-Free

Source

E.Coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using murine lymphocytes is in a concentration of 10-100 ng/ml.

Form

Lyophilized powder

Molecular Weight

10.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

VTIPSSCCTSFISKKIPENRVVSYQLANGSICPKAGVIFITKKGHKICTDPKLLWVQRHIQKLDAKKNQPSKGAKAVRTKFAVQRRRGNSTEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EOMES (Eomesodermin Homolog, T-box Brain Protein 2, TBR2, T-brain-2, TBR-2) discontinued
E3321-AP 100 µL

EOMES (Eomesodermin Homolog, T-box Brain Protein 2, TBR2, T-brain-2, TBR-2) discontinued

Sign In for Pricing
View Details
Fmoc- (S) -3-amino-5-carboxymethyl-2,3-dihydro-1,5-benzoxazepin-4 (5H) -one ≥98.5% (HPLC)
237893-01 100 mg

Fmoc- (S) -3-amino-5-carboxymethyl-2,3-dihydro-1,5-benzoxazepin-4 (5H) -one ≥98.5% (HPLC)

Sign In for Pricing
View Details
Fmoc- (S) -3-amino-5-carboxymethyl-2,3-dihydro-1,5-benzoxazepin-4 (5H) -one ≥98.5% (HPLC)
237893-02 250 mg

Fmoc- (S) -3-amino-5-carboxymethyl-2,3-dihydro-1,5-benzoxazepin-4 (5H) -one ≥98.5% (HPLC)

Sign In for Pricing
View Details
Fmoc- (S) -3-amino-5-carboxymethyl-2,3-dihydro-1,5-benzoxazepin-4 (5H) -one ≥98.5% (HPLC)
237893-03 1 g

Fmoc- (S) -3-amino-5-carboxymethyl-2,3-dihydro-1,5-benzoxazepin-4 (5H) -one ≥98.5% (HPLC)

Sign In for Pricing
View Details
Uncharacterized protein C17orf90 (C17orf90) Human ELISA Kit
I0866 96 Tests

Uncharacterized protein C17orf90 (C17orf90) Human ELISA Kit

Sign In for Pricing
View Details
NEU2 Rabbit Polyclonal Antibody (BF594)
orb2442393 100 µL

NEU2 Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details