Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse CCL22 protein (Active)

This Mouse CCL22 protein (Active) spans the amino acid sequence from region 25-92aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

A 152E5.1 protein, ABCD 1 protein, C C motif chemokine 22 protein, CC chemokine STCP 1 protein, CC chemokine STCP-1 protein, ccl 22 protein, Ccl22 protein, CCL22_HUMAN protein, Chemokine (C C motif) ligand 22 protein, DCBCK protein, Macrophage-derived chemokine protein, MDC protein, Small inducible cytokine subfamily A member 22 protein, Small-inducible cytokine A22 protein, STCP 1 protein, Stimulated T cell chemotactic protein 1 protein

UniProt

O88430

Expression Region

25-92aa

Tag

Tag-Free

Source

E.Coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Form

Lyophilized powder

Molecular Weight

7.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

GPYGANVEDSICCQDYIRHPLPSRLVKEFFWTSKSCRKPGVVLITVKNRDICADPRQVWVKKLLHKLS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human alpha-Actinin 1/ACTN1 antibody
ATGA0377-100 100 µL

Human alpha-Actinin 1/ACTN1 antibody

Sign In for Pricing
View Details
CETN2 Peptide - middle region
MBS3245792-01 0.1 mg

CETN2 Peptide - middle region

Sign In for Pricing
View Details
CETN2 Peptide - middle region
MBS3245792-02 5x 0.1 mg

CETN2 Peptide - middle region

Sign In for Pricing
View Details
Recombinant Ictalurid herpesvirus 1 Putative membrane protein ORF7 (ORF7)
MBS7025191-01 0.02 mg

Recombinant Ictalurid herpesvirus 1 Putative membrane protein ORF7 (ORF7)

Sign In for Pricing
View Details
Recombinant Ictalurid herpesvirus 1 Putative membrane protein ORF7 (ORF7)
MBS7025191-02 0.1 mg

Recombinant Ictalurid herpesvirus 1 Putative membrane protein ORF7 (ORF7)

Sign In for Pricing
View Details
Recombinant Ictalurid herpesvirus 1 Putative membrane protein ORF7 (ORF7)
MBS7025191-03 5x 0.1 mg

Recombinant Ictalurid herpesvirus 1 Putative membrane protein ORF7 (ORF7)

Sign In for Pricing
View Details