Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse CC21C protein (Active)

This Mouse CC21C protein (Active) spans the amino acid sequence from region 24-133aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

6Ckine, Small-inducible cytokine A21c, Thymus-derived chemotactic agent 4, TCA4

UniProt

P86793

Expression Region

24-133aa

Tag

Tag-Free

Source

E.Coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using murine T-lymphocytes is in a concentration range of 10-100 ng/ml.

Form

Lyophilized powder

Molecular Weight

12.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl , pH 7.4

AA Sequence

SDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFLPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNX18P8 Protein Vector (Human) (pPB-N-His)
PV132559 500 ng

SNX18P8 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
KDM1A Antibody
orb1923649-01 20 ul

KDM1A Antibody

Sign In for Pricing
View Details
KDM1A Antibody
orb1923649-02 50 µL

KDM1A Antibody

Sign In for Pricing
View Details
KDM1A Antibody
orb1923649-03 100 µL

KDM1A Antibody

Sign In for Pricing
View Details
TRMT12 Rabbit pAb, PerCP-Cy7 conjugated
orb2845738 100 µL

TRMT12 Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
SETD7 Rabbit Polyclonal Antibody (HRP)
orb2113709 100 µL

SETD7 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details