Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse CCL20 protein (Active)

This Mouse CCL20 protein (Active) spans the amino acid sequence from region 28-97aa. Purity: > 96% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Beta-chemokine exodus-1, CC chemokine ST38, Liver and activation-regulated chemokine, Macrophage inflammatory protein 3 alpha, MIP-3-alpha

UniProt

O89093

Expression Region

28-97aa

Tag

Tag-Free

Source

E.Coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 96% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biologically active determined by a chemotaxis bioassay using human CCR6 transfected murine BaF3 cells is in a concentration range of 0.1-10 ng/ml.

Form

Lyophilized powder

Molecular Weight

8.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NIPSNAP3B (NM_018376) Human Over-expression Lysate
LC413071 20 µg

NIPSNAP3B (NM_018376) Human Over-expression Lysate

Sign In for Pricing
View Details
Pde6g sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3361302 1.0 µg DNA

Pde6g sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Recombinant Bordetella Avium argH Protein (aa 1-470)
VAng-Lsx4064-50gEcoli 50 µg (E. coli)

Recombinant Bordetella Avium argH Protein (aa 1-470)

Sign In for Pricing
View Details
Rabbit anti-Factor I Antibody
MBS4506268-01 0.05 mL

Rabbit anti-Factor I Antibody

Sign In for Pricing
View Details
Rabbit anti-Factor I Antibody
MBS4506268-02 0.1 mL

Rabbit anti-Factor I Antibody

Sign In for Pricing
View Details
Rabbit anti-Factor I Antibody
MBS4506268-03 5x 0.1 mL

Rabbit anti-Factor I Antibody

Sign In for Pricing
View Details