Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse MIP3 beta protein (Active)

This Mouse MIP3 beta protein (Active) spans the amino acid sequence from region 26-108aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Beta chemokine exodus 3 protein, C C motif chemokine 19 protein, CCL19 protein, CK beta 11 protein, CKb11 protein, EBI1 ligand chemokine protein, ELC protein, MIP 3 beta protein, MIP 3b protein, MIP3B protein, MIP-3-beta protein, SCYA19 protein, Small inducible cytokine A19 protein, MIP-3-beta protein, MIP3beta protein

UniProt

O70460

Expression Region

26-108aa

Tag

Tag-Free

Source

E.Coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human mature dendritic cells is in a concentration range of 10-100 ng/ml.

Form

Lyophilized powder

Molecular Weight

9.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

GANDAEDCCLSVTQRPIPGNIVKAFRYLLNEDGCRVPAVVFTTLRGYQLCAPPDQPWVDRIIRRLKKSSAKNKGNSTRRSPVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Choline Acetyltransferase/CHAT Antibody Picoband®, Cy3 Conjugate
A01192-4-Cy3 100 µg/Vial

Anti-Choline Acetyltransferase/CHAT Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details
JHDM1D 3'UTR GFP Stable Cell Line
TU061398 1.0 mL

JHDM1D 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Cytochalasin B
HY-16928-01 1 mg

Cytochalasin B

Sign In for Pricing
View Details
Cytochalasin B
HY-16928-02 5 mg

Cytochalasin B

Sign In for Pricing
View Details
Cytochalasin B
HY-16928-03 10 mM - 1 mL

Cytochalasin B

Sign In for Pricing
View Details
Cytochalasin B
HY-16928-04 10 mg

Cytochalasin B

Sign In for Pricing
View Details