Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Q9WUZ6 protein (Active)

This Mouse Q9WUZ6 protein (Active) spans the amino acid sequence from region 24-93aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

ABCD-2

UniProt

Q9WUZ6

Expression Region

24-93aa

Tag

Tag-Free

Source

E.Coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biologically active determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration range of 1.0-10 ng/ml.

Form

Lyophilized powder

Molecular Weight

7.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

ARATNVGRECCLDYFKGAIPIRKLVSWYKTSVECSRDAIVFLTVQGKLICADPKDKHVKKAIRLVKNPRP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ndst3 sgRNA CRISPR Lentivector set (Mouse)
K4122101 3x 1.0 µg

Ndst3 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Rabbit anti-Oryza sativa subsp. japonica (Rice) CR4 Polyclonal Antibody
MBS7186657 Inquire

Rabbit anti-Oryza sativa subsp. japonica (Rice) CR4 Polyclonal Antibody

Sign In for Pricing
View Details
LOC689948 3'UTR Luciferase Stable Cell Line
TU212016 1.0 mL

LOC689948 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Guinea-pig γGT1 (Gamma Glutamyltransferase 1) ValidElisa Kit
EK347536 96 Well

Guinea-pig γGT1 (Gamma Glutamyltransferase 1) ValidElisa Kit

Sign In for Pricing
View Details
Rabbit Polyclonal LMX1b Antibody [mFluor Violet 450 SE]
NBP3-06531MFV450 0.1 mL

Rabbit Polyclonal LMX1b Antibody [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Recombinant Human Low-density lipoprotein receptor-related protein 4 (LRP4), partial
CSB-EP013099HU-01 20 µg

Recombinant Human Low-density lipoprotein receptor-related protein 4 (LRP4), partial

Sign In for Pricing
View Details