Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Q9WUZ6 protein (Active)

This Mouse Q9WUZ6 protein (Active) spans the amino acid sequence from region 24-93aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

ABCD-2

UniProt

Q9WUZ6

Expression Region

24-93aa

Tag

Tag-Free

Source

E.Coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biologically active determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration range of 1.0-10 ng/ml.

Form

Lyophilized powder

Molecular Weight

7.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

ARATNVGRECCLDYFKGAIPIRKLVSWYKTSVECSRDAIVFLTVQGKLICADPKDKHVKKAIRLVKNPRP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACP2 Antibody
B2015815 50 µg

ACP2 Antibody

Sign In for Pricing
View Details
RFX1, CT (RFX1, MHC class II regulatory factor RFX1, Enhancer factor C, Regulatory factor X 1, Transcription factor RFX1) (APC) discontinued
040985-APC 200 µL

RFX1, CT (RFX1, MHC class II regulatory factor RFX1, Enhancer factor C, Regulatory factor X 1, Transcription factor RFX1) (APC) discontinued

Sign In for Pricing
View Details
Human CGb (Chorionic Gonadotropin Beta Polypeptide) Microsample ELISA Kit
orb2998068-01 48 Tests

Human CGb (Chorionic Gonadotropin Beta Polypeptide) Microsample ELISA Kit

Sign In for Pricing
View Details
Human CGb (Chorionic Gonadotropin Beta Polypeptide) Microsample ELISA Kit
orb2998068-02 96 Tests

Human CGb (Chorionic Gonadotropin Beta Polypeptide) Microsample ELISA Kit

Sign In for Pricing
View Details
Recombinant Agrobacterium radiobacter Ribosome maturation factor RimM (rimM)
MBS1243435-01 0.02 mg (E-Coli)

Recombinant Agrobacterium radiobacter Ribosome maturation factor RimM (rimM)

Sign In for Pricing
View Details
Recombinant Agrobacterium radiobacter Ribosome maturation factor RimM (rimM)
MBS1243435-02 0.1 mg (E-Coli)

Recombinant Agrobacterium radiobacter Ribosome maturation factor RimM (rimM)

Sign In for Pricing
View Details