Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse CCL11 protein (Active)

This Mouse CCL11 protein (Active) spans the amino acid sequence from region 24-97aa. Purity: > 96% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

C-C motif chemokine 11, Small-inducible cytokine A11

UniProt

P48298

Expression Region

24-97aa

Tag

Tag-Free

Source

E.Coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 96% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using purified eosinophils is in a concentration range of 100-1000 ng/ml.

Form

Lyophilized powder

Molecular Weight

8.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

HPGSIPTSCCFIMTSKKIPNTLLKSYKRITNNRCTLKAIVFKTRLGKEICADPKKKWVQDATKHLDQKLQTPKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCTD4 Rabbit Polyclonal Antibody (HRP)
orb2133297 100 µL

KCTD4 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Anti-Fruit fly Drp1 Antibody Fluoro488 Conjugated
DZ41314-Fluoro488 200 µL/Vial

Anti-Fruit fly Drp1 Antibody Fluoro488 Conjugated

Sign In for Pricing
View Details
Mash1 (L68) (Achaete-scute homolog 1,ASCL1,ASH1, BHLHA46, HASH1) (FITC)
MBS6319103-01 0.2 mL

Mash1 (L68) (Achaete-scute homolog 1,ASCL1,ASH1, BHLHA46, HASH1) (FITC)

Sign In for Pricing
View Details
Mash1 (L68) (Achaete-scute homolog 1,ASCL1,ASH1, BHLHA46, HASH1) (FITC)
MBS6319103-02 5x 0.2 mL

Mash1 (L68) (Achaete-scute homolog 1,ASCL1,ASH1, BHLHA46, HASH1) (FITC)

Sign In for Pricing
View Details
ZDHHC8 Rabbit Polyclonal Antibody (APC-Cy7)
orb1571849 100 µL

ZDHHC8 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
Collagen XIII alpha 1 polyclonal antibody
BZ16259-01 50 µL

Collagen XIII alpha 1 polyclonal antibody

Sign In for Pricing
View Details