Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse CCL11 protein (Active)

This Mouse CCL11 protein (Active) spans the amino acid sequence from region 24-97aa. Purity: > 96% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

C-C motif chemokine 11, Small-inducible cytokine A11

UniProt

P48298

Expression Region

24-97aa

Tag

Tag-Free

Source

E.Coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 96% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using purified eosinophils is in a concentration range of 100-1000 ng/ml.

Form

Lyophilized powder

Molecular Weight

8.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

HPGSIPTSCCFIMTSKKIPNTLLKSYKRITNNRCTLKAIVFKTRLGKEICADPKKKWVQDATKHLDQKLQTPKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Collagen VI Recombinant Rabbit mAb, BF680 conjugated
orb3126611 100 µL

Collagen VI Recombinant Rabbit mAb, BF680 conjugated

Sign In for Pricing
View Details
Human CARD6 Pre-designed siRNA Set A
SI002188A 1 Each

Human CARD6 Pre-designed siRNA Set A

Sign In for Pricing
View Details
SOCS3 Antibody
orb1336168 100 µg

SOCS3 Antibody

Sign In for Pricing
View Details
GCLC Antibody
F41799-0.08ML 0.08 mL

GCLC Antibody

Sign In for Pricing
View Details
Recombinant Klebsiella pneumoniae Electron transport complex protein RnfA (rnfA)
orb2912908-01 20 µg

Recombinant Klebsiella pneumoniae Electron transport complex protein RnfA (rnfA)

Sign In for Pricing
View Details
Recombinant Klebsiella pneumoniae Electron transport complex protein RnfA (rnfA)
orb2912908-02 100 µg

Recombinant Klebsiella pneumoniae Electron transport complex protein RnfA (rnfA)

Sign In for Pricing
View Details