Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse CCL11 protein (Active)

This Mouse CCL11 protein (Active) spans the amino acid sequence from region 24-97aa. Purity: > 96% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

C-C motif chemokine 11, Small-inducible cytokine A11

UniProt

P48298

Expression Region

24-97aa

Tag

Tag-Free

Source

E.Coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 96% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using purified eosinophils is in a concentration range of 100-1000 ng/ml.

Form

Lyophilized powder

Molecular Weight

8.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

HPGSIPTSCCFIMTSKKIPNTLLKSYKRITNNRCTLKAIVFKTRLGKEICADPKKKWVQDATKHLDQKLQTPKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GENLISA Human Rotavirus Antigen (RV Ag) ELISA
KBH15731 1x 96 Well

GENLISA Human Rotavirus Antigen (RV Ag) ELISA

Sign In for Pricing
View Details
TSPAN32 Antibody, FITC conjugated
CSB-PA842746LC01HU-01 50 µg

TSPAN32 Antibody, FITC conjugated

Sign In for Pricing
View Details
TSPAN32 Antibody, FITC conjugated
CSB-PA842746LC01HU-02 100 µg

TSPAN32 Antibody, FITC conjugated

Sign In for Pricing
View Details
RCSD1 (RCSD Domain-containing Protein 1, CapZ-interacting Protein, CAPZIP, Protein Kinase Substrate CapZIP, MK2S4, RP3-503M14.1) (MaxLight 405)
MBS6192236-01 0.1 mL

RCSD1 (RCSD Domain-containing Protein 1, CapZ-interacting Protein, CAPZIP, Protein Kinase Substrate CapZIP, MK2S4, RP3-503M14.1) (MaxLight 405)

Sign In for Pricing
View Details
RCSD1 (RCSD Domain-containing Protein 1, CapZ-interacting Protein, CAPZIP, Protein Kinase Substrate CapZIP, MK2S4, RP3-503M14.1) (MaxLight 405)
MBS6192236-02 5x 0.1 mL

RCSD1 (RCSD Domain-containing Protein 1, CapZ-interacting Protein, CAPZIP, Protein Kinase Substrate CapZIP, MK2S4, RP3-503M14.1) (MaxLight 405)

Sign In for Pricing
View Details
Mouse Chsy3 qPCR Primer Pair
QM46458S 200 Tests

Mouse Chsy3 qPCR Primer Pair

Sign In for Pricing
View Details