Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse CCL8 protein (Active)

This Mouse CCL8 protein (Active) spans the amino acid sequence from region 24-97aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Monocyte chemoattractant protein 2, MCP-2, Small-inducible cytokine A8

UniProt

Q9Z121

Expression Region

24-97aa

Tag

Tag-Free

Source

E.Coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood monocytes is in a concentration range of 10-100 ng/ml.

Form

Lyophilized powder

Molecular Weight

8.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

GPDKAPVTCCFHVLKLKIPLRVLKSYERINNIQCPMEAVVFQTKQGMSLCVDPTQKWVSEYMEILDQKSQILQP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZBTB17 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
50689124 3x 1.0µg DNA

ZBTB17 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
STK35 CRISPR Knock Out 293T Cell Line (Human)
45747141 1x 10^6 Cells / 1.0 mL

STK35 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Castor2 Mouse shRNA Lentiviral Particle (Locus ID 80909)
TL519586V 500 µL Each

Castor2 Mouse shRNA Lentiviral Particle (Locus ID 80909)

Sign In for Pricing
View Details
GJB1 Protein Vector (Rat) (pPB-C-His)
PV270262 500 ng

GJB1 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Rat Il2ra/Interleukin-2 receptor subunit alpha ELISA Kit
E0519Ra 96 Tests

Rat Il2ra/Interleukin-2 receptor subunit alpha ELISA Kit

Sign In for Pricing
View Details
Anti-RGS2 Antibody (L33/33)
RHE30601 100 μg

Anti-RGS2 Antibody (L33/33)

Sign In for Pricing
View Details