Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse CCL8 protein (Active)

This Mouse CCL8 protein (Active) spans the amino acid sequence from region 24-97aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Monocyte chemoattractant protein 2, MCP-2, Small-inducible cytokine A8

UniProt

Q9Z121

Expression Region

24-97aa

Tag

Tag-Free

Source

E.Coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood monocytes is in a concentration range of 10-100 ng/ml.

Form

Lyophilized powder

Molecular Weight

8.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

GPDKAPVTCCFHVLKLKIPLRVLKSYERINNIQCPMEAVVFQTKQGMSLCVDPTQKWVSEYMEILDQKSQILQP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNU6ATAC4P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1854208 1.0 µg DNA

RNU6ATAC4P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Rabbit anti-Mouse IgG Fc Antibody, Biotin conjugated
A17887-500UG 500 µg

Rabbit anti-Mouse IgG Fc Antibody, Biotin conjugated

Sign In for Pricing
View Details
Lmbr1l (NM_001013950) Rat Untagged Clone
RN212410 10 µg

Lmbr1l (NM_001013950) Rat Untagged Clone

Sign In for Pricing
View Details
RPS6KB1 Mouse mAb, PE-Cy7 conjugated
orb2888192 100 µL

RPS6KB1 Mouse mAb, PE-Cy7 conjugated

Sign In for Pricing
View Details
CAVIN1 (NM_012232) Human Over-expression Lysate
LC402171 20 µg

CAVIN1 (NM_012232) Human Over-expression Lysate

Sign In for Pricing
View Details
ZNF26 siRNA (Human)
MBS8201078-01 15 nmol

ZNF26 siRNA (Human)

Sign In for Pricing
View Details