Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse CCL6 protein (Active)

This Mouse CCL6 protein (Active) spans the amino acid sequence from region 22-116aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Protein C10, , ; CCL623-95, ]

UniProt

P27784

Expression Region

22-116aa

Tag

Tag-Free

Source

E.Coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biologically active determined by a chemotaxis bioassay using human CCR1 transfected murine BaF3 cells is in a concentration range of 10-100 ng/ml.

Form

Lyophilized powder

Molecular Weight

10.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

GLIQEIEKEDRRYNPPIIHQGFQDTSSDCCFSYATQIPCKRFIYYFPTSGGCIKPGIIFISRRGTQVCADPSDRRVQRCLSTLKQGPRSGNKVIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRT8P11 CRISPRa sgRNA lentivector (set of three targets)(Human)
26059121 3x 1.0µg DNA

KRT8P11 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
OTX2 Antibody, HRP conjugated
A30492-100UG 100 µg

OTX2 Antibody, HRP conjugated

Sign In for Pricing
View Details
PON3 Mouse Monoclonal Antibody [Clone ID: OTI1B12]
TA807383 100 µL

PON3 Mouse Monoclonal Antibody [Clone ID: OTI1B12]

Sign In for Pricing
View Details
HLAG Polyclonal Antibody
UB-GEN-7582 100 µL

HLAG Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Bordetella Parapertussis nuoC Protein (aa 1-215)
VAng-Lsx4521-1mgEcoli 1 mg (E. coli)

Recombinant Bordetella Parapertussis nuoC Protein (aa 1-215)

Sign In for Pricing
View Details
FRA11G sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0808505 3x 1.0 µg

FRA11G sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details