Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse CCL6 protein (Active)

This Mouse CCL6 protein (Active) spans the amino acid sequence from region 22-116aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Protein C10, , ; CCL623-95, ]

UniProt

P27784

Expression Region

22-116aa

Tag

Tag-Free

Source

E.Coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biologically active determined by a chemotaxis bioassay using human CCR1 transfected murine BaF3 cells is in a concentration range of 10-100 ng/ml.

Form

Lyophilized powder

Molecular Weight

10.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

GLIQEIEKEDRRYNPPIIHQGFQDTSSDCCFSYATQIPCKRFIYYFPTSGGCIKPGIIFISRRGTQVCADPSDRRVQRCLSTLKQGPRSGNKVIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SFRS2B, NT (SRSF8, SFRS2B, SRP46, Serine/arginine-rich splicing factor 8, Pre-mRNA-splicing factor SRP46, Splicing factor, arginine/serine-rich 2B) (MaxLight 750) discontinued
041632-ML750 100 µL

SFRS2B, NT (SRSF8, SFRS2B, SRP46, Serine/arginine-rich splicing factor 8, Pre-mRNA-splicing factor SRP46, Splicing factor, arginine/serine-rich 2B) (MaxLight 750) discontinued

Sign In for Pricing
View Details
WDR92 (Biotin)
581521-01 50 µL

WDR92 (Biotin)

Sign In for Pricing
View Details
WDR92 (Biotin)
581521-02 100 µL

WDR92 (Biotin)

Sign In for Pricing
View Details
TRNAI19 sgRNA CRISPR Lentivector (Human) (Target 2)
K2494403 1.0 µg DNA

TRNAI19 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
SOCS2 (3T6) Rabbit Monoclonal Antibody
E28M5806 100 µL

SOCS2 (3T6) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
5-Lipoxygenase (5-LO) Magnetic Luminex Assay Kit
LKU604702 96 Tests

5-Lipoxygenase (5-LO) Magnetic Luminex Assay Kit

Sign In for Pricing
View Details