Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse CCL6 protein (Active)

This Mouse CCL6 protein (Active) spans the amino acid sequence from region 22-116aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Protein C10, , ; CCL623-95, ]

UniProt

P27784

Expression Region

22-116aa

Tag

Tag-Free

Source

E.Coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biologically active determined by a chemotaxis bioassay using human CCR1 transfected murine BaF3 cells is in a concentration range of 10-100 ng/ml.

Form

Lyophilized powder

Molecular Weight

10.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

GLIQEIEKEDRRYNPPIIHQGFQDTSSDCCFSYATQIPCKRFIYYFPTSGGCIKPGIIFISRRGTQVCADPSDRRVQRCLSTLKQGPRSGNKVIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BBS9 Rabbit Polyclonal Antibody (AP)
orb868068 100 µL

BBS9 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
[Tyr0]-Orexin B (Biotin) Peptide
abx265406-01 1 mg

[Tyr0]-Orexin B (Biotin) Peptide

Sign In for Pricing
View Details
[Tyr0]-Orexin B (Biotin) Peptide
abx265406-02 5 mg

[Tyr0]-Orexin B (Biotin) Peptide

Sign In for Pricing
View Details
[Tyr0]-Orexin B (Biotin) Peptide
abx265406-03 10 mg

[Tyr0]-Orexin B (Biotin) Peptide

Sign In for Pricing
View Details
Dennd3 Mouse qPCR Primer Pair (NM_001081066)
MP203566 200 Reactions

Dennd3 Mouse qPCR Primer Pair (NM_001081066)

Sign In for Pricing
View Details
Mouse VCL (Vinculin) ELISA Kit
EK242284 96 Well

Mouse VCL (Vinculin) ELISA Kit

Sign In for Pricing
View Details