Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse RANTES protein (Active)

This Mouse RANTES protein (Active) spans the amino acid sequence from region 24-91aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Beta chemokine RANTES protein, C C motif chemokine 5 protein, CCL 5 protein, CCL5 protein, Chemokine (C C motif) ligand 5 protein, Chemokine CC Motif Ligand 5 protein, EoCP protein, Eosinophil chemotactic cytokine protein, MGC17164 protein, RANTES (4-68) protein, Regulated upon activation normally T expressed and presumably secreted protein, SCYA 5 protein, SCYA5 protein, SIS delta protein, Small inducible cytokine A5 (RANTES) protein, Small-inducible cytokine A5 protein, T cell specific protein p288 protein, T cell specific RANTES protein protein, TCP228 protein

UniProt

P30882

Expression Region

24-91aa

Tag

Tag-Free

Source

E.Coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human T lymphocytes is in a concentration range of 1.0-10 ng/ml.

Form

Lyophilized powder

Molecular Weight

7.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered concentrated solution in 30 % Acetonitrile and 0.1 % TFA

AA Sequence

SPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCANPEKKWVQEYINYLEMS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 13 Antibody
R36291-100UG 100 µg

Cytokeratin 13 Antibody

Sign In for Pricing
View Details
GTF2E2, CT (GTF2E2, TF2E2, Transcription initiation factor IIE subunit beta, General transcription factor IIE subunit 2) (FITC) discontinued
036355-FITC 200 µL

GTF2E2, CT (GTF2E2, TF2E2, Transcription initiation factor IIE subunit beta, General transcription factor IIE subunit 2) (FITC) discontinued

Sign In for Pricing
View Details
RGS6 Peptide
DF15366-BP 1 mg

RGS6 Peptide

Sign In for Pricing
View Details
Phosphotyrosine (Biotin)
P4078-01A-Biotin 100 µL

Phosphotyrosine (Biotin)

Sign In for Pricing
View Details
JAB-3312
E4705-100mg 100 mg

JAB-3312

Sign In for Pricing
View Details
Anti-COL4A2 Antibody , Dylight550 Conjugate
A02453-1-Dylight550 100 µg

Anti-COL4A2 Antibody , Dylight550 Conjugate

Sign In for Pricing
View Details