Mouse RANTES protein (Active)
This Mouse RANTES protein (Active) spans the amino acid sequence from region 24-91aa. Purity: > 97% as determined by SDS-PAGE and HPLC.
Product Specifications
Product Name Alternative
Beta chemokine RANTES protein, C C motif chemokine 5 protein, CCL 5 protein, CCL5 protein, Chemokine (C C motif) ligand 5 protein, Chemokine CC Motif Ligand 5 protein, EoCP protein, Eosinophil chemotactic cytokine protein, MGC17164 protein, RANTES (4-68) protein, Regulated upon activation normally T expressed and presumably secreted protein, SCYA 5 protein, SCYA5 protein, SIS delta protein, Small inducible cytokine A5 (RANTES) protein, Small-inducible cytokine A5 protein, T cell specific protein p288 protein, T cell specific RANTES protein protein, TCP228 protein
UniProt
P30882
Expression Region
24-91aa
Tag
Tag-Free
Source
E.Coli
Origin
Mus musculus (Mouse)
Field of Research
Immunology & Inflammation
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
> 97% as determined by SDS-PAGE and HPLC.
Bioactivity
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human T lymphocytes is in a concentration range of 1.0-10 ng/ml.
Form
Lyophilized powder
Molecular Weight
7.9 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
Lyophilized from a 0.2 μm filtered concentrated solution in 30 % Acetonitrile and 0.1 % TFA
AA Sequence
SPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCANPEKKWVQEYINYLEMS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog